PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g019213m
Common NameCISIN_1g019213mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family SRS
Protein Properties Length: 345aa    MW: 36852.8 Da    PI: 7.6574
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g019213mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702217.33.3e-671162624154
             DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssae 95 
                        g++sCqdCGnqakkdCah+RCRtCCksrgfdC+thvkstWv+a+krre+qqqla ++  +  + + +++kr+re  +  +s+l++++l+ + 
  orange1.1g019213m 116 GGMSCQDCGNQAKKDCAHMRCRTCCKSRGFDCQTHVKSTWVAASKRREKQQQLALQQ--QRLQLRGETNKRPREA-NPISSSLACSRLPANA 204
                        789**********************************************99998864..4456788999999997.6678899999999988 PP

             DUF702  96 skkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                        s  e+ +++lP evs++avfrcv+vs++dd+e+++aYqt+v+igGh+fkGiLydqG+e+
  orange1.1g019213m 205 SGFEV-AENLPGEVSTQAVFRCVKVSGIDDSEDQFAYQTSVNIGGHLFKGILYDQGPES 262
                        77555.556************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.8E-63117261IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.3E-26119161IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.3E-26213260IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010252Biological Processauxin homeostasis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048479Biological Processstyle development
GO:0048480Biological Processstigma development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MAGFFSLGRV SSSSNNNQED QQHNPANPIT PENWFWYKNE DISYKQGASF ELWQQQAELL  60
LQQRQQQQQD LYSSSAAAGL GMGPISRSAI NVVGGIDNSS SRSAFMMVRS SSGIGGGMSC  120
QDCGNQAKKD CAHMRCRTCC KSRGFDCQTH VKSTWVAASK RREKQQQLAL QQQRLQLRGE  180
TNKRPREANP ISSSLACSRL PANASGFEVA ENLPGEVSTQ AVFRCVKVSG IDDSEDQFAY  240
QTSVNIGGHL FKGILYDQGP ESTYTTGESS SGGGIQLQPL NLVTAGAGPD PVNTTATPVS  300
PAAAAVTASS STAAFLDPSS LYPTPFTTFM AAAGTQFFPS PRSS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00613PBMTransfer from AT3G51060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006466883.10.0PREDICTED: protein SHI RELATED SEQUENCE 1 isoform X1
SwissprotQ9SD402e-94SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
SwissprotQ9XGX01e-94SHI_ARATH; Protein SHORT INTERNODES
TrEMBLA0A067FUL10.0A0A067FUL1_CITSI; Uncharacterized protein
STRINGPOPTR_0005s12020.11e-106(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34192864
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.12e-70Lateral root primordium (LRP) protein-related